PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN28149.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family SRS
Protein Properties Length: 307aa    MW: 32665.6 Da    PI: 6.9689
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN28149.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702211.71.8e-65942542154
      DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkel 100
                 +sgt +CqdCGnqakkdC+h+RCRtCCksrgfdCathvkstWvpa++rrerq ++ aa++++    +++ +k++r   s+++s +s+++ +++++++++
  KHN28149.1  94 GSGTNTCQDCGNQAKKDCSHRRCRTCCKSRGFDCATHVKSTWVPASRRRERQLMTVAAARSSG---DTSGAKKPRLVASQTTSHTSTSNNTNTTPPRSF 189
                 57899**********************************************988887755554...567778888887777777777788888888999 PP

      DUF702 101 etss..........lPeevsseavfrcvrvssvdd.geeelaYqtavsigGhvfkGiLydqGlee 154
                 +t s          lP +v+++avf+cvrv++vdd ge+e+aYq++v+igGhvfkG+LydqG+e+
  KHN28149.1 190 DTGSshqdvgfkesLPCQVRAPAVFKCVRVTAVDDgGEDEYAYQAVVKIGGHVFKGFLYDQGVED 254
                 88888899999999*********************899*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051429.6E-6197253IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016238.7E-2799141IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.2E-29204252IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
PASSFHHHHD HNDAVLSDPN NGSNNSNNNP GTALGVNVFP LLTATPCLES EGIMGNISHH  60
RNRIQLWEDH ESSPPQQQQG HVERDTCGDG GLGGSGTNTC QDCGNQAKKD CSHRRCRTCC  120
KSRGFDCATH VKSTWVPASR RRERQLMTVA AARSSGDTSG AKKPRLVASQ TTSHTSTSNN  180
TNTTPPRSFD TGSSHQDVGF KESLPCQVRA PAVFKCVRVT AVDDGGEDEY AYQAVVKIGG  240
HVFKGFLYDQ GVEDKEGYPN LSELHLGGGN GVSSSSPMVD PSHDVYAASG GGLLLGGSSN  300
YGNHPIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006583967.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
RefseqXP_006583968.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
RefseqXP_006583969.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
RefseqXP_014633679.10.0PREDICTED: protein LATERAL ROOT PRIMORDIUM 1-like
SwissprotQ94CK94e-82LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLA0A0B2R7L10.0A0A0B2R7L1_GLYSO; Uncharacterized protein (Fragment)
STRINGGLYMA07G35780.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.23e-77Lateral root primordium (LRP) protein-related
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]